PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0336s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 290aa    MW: 32765.4 Da    PI: 5.2107
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0336s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox491e-152073457
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          R++ +++qle Le+++++++ ps + r+ L+k+lgL+e+q +vWF  rR k+++
  Sphfalx0336s0007.1.p 20 RRKKSASQLELLEKVYAEDKFPSIAFRAGLTKELGLSEKQLQVWFTHRRRKDRR 73
                          88999***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-16373IPR009057Homeodomain-like
SuperFamilySSF466891.54E-15573IPR009057Homeodomain-like
PROSITE profilePS5007116.1471474IPR001356Homeobox domain
SMARTSM003893.6E-141678IPR001356Homeobox domain
CDDcd000868.53E-131773No hitNo description
PfamPF000463.3E-132073IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MASDDSSPAA SLEKQKRGIR RKKSASQLEL LEKVYAEDKF PSIAFRAGLT KELGLSEKQL  60
QVWFTHRRRK DRRDGIDVDQ LMPHGNNHCN SERQGDDDDE PELLQEMQLH LNSREEDGSC  120
LKDRYPISVV EDDDDDDDDD VIIIESINGT DRSNAKLEKI QKPKPAIARK EIAPQSKQAG  180
EKQLPFWRSN LEPEVNITNN AEAAHELAAI AAVEMQLRGP MQDDGPPLGF EFDSLPPDAF  240
QEFTGRQGGI YSADRSENLL TGRGSARSSR KSKNLKFRDK KKRKLEYFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16673RRRKDRRD
2269284RKSKNLKFRDKKKRKL
3274283LKFRDKKKRK
4279284KKKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.18e-15homeobox-1